Total number of results for Eurydice pulchra are 2
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00758 |
QSRDFSISEREIVASLAKQLLRVARMGYVPEGDLPR
|
36 | Eurydice pulchra | Arthropod PDH | PDH precursor-related peptide(Potential) | ||
| NP00759 |
NAELINSLLGVPRVMSDA
|
18 | Eurydice pulchra | Arthropod PDH | Pigment-dispersing hormone | 21192084#Wilcockson D.C., Zhang L., Hastings M.H., Kyriacou C.P., Webster S.G.; #A novel form of pigment-dispersing hormone in the central nervous system of the intertidal marine isopod, Eurydice pulchra (leach).; #J. Comp. Neurol. 519:562-575(2011). |